TDO2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6766
Additional Names:: HYPTRP|TDO|TDO2|TO|TPH2|TRPO
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 48 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKT
Uniprot:: P48775
Synonyms:: HYPTRP;TDO;TO;TPH2;TRPO;tryptamin 2,3-dioxygenase;tryptophan 2,3-dioxygenase;tryptophan oxygenase;tryptophan pyrrolase;tryptophanase
Extra Details:: This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism.