A6759
TAF1C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6759
- Additional Names:
- MGC:39976|SL1|TAF1C|TAFI110|TAFI95
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PPLIDPWDPGLTARDLLFRGGYRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQFGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGETLLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSP
- Uniprot:
- Q15572
- Synonyms:
- MGC:39976;RNA polymerase I-specific TBP-associated factor 110 kDa;SL1;SL1, 110kD subunit;TAFI110;TAFI95;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa;TATA box-binding protein-associated factor 1C;TATA box-binding protein-associated factor RNA polymerase I subunit C;TATA-box binding protein associated factor, RNA polymerase I, C;TBP-associated factor 1C;transcription factor SL1;transcription initiation factor SL1/TIF-IB subunit C
- Extra Details:
- Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice