A6754
ST8SIA4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6754
- Additional Names:
- PST|PST1|SIAT8D|ST8SIA-IV|ST8SIA4
- Application:
- ELISA, WB
- Molecular Weight:
- 41kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
- Uniprot:
- Q92187
- Synonyms:
- alpha-2,8-sialyltransferase 8D;CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase;CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase;polysialyltransferase-1;PST;PST1;sialyltransferase 8 (alpha-2, 8-polysialytransferase) D;sialyltransferase 8D;sialyltransferase St8Sia IV;sialytransferase St8Sia IV;SIAT8-D;SIAT8D;ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 4;ST8SIA-IV;ST8SiaIV
- Extra Details:
- The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice