A6742
SLC34A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6742
- Additional Names:
- FRTS2|HCINF2|NAPI-3|NPHLOP1|NPT2|NPTIIa|SLC11|SLC17A2|SLC34A1
- Application:
- ELISA, WB
- Molecular Weight:
- 75-80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCCARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
- Uniprot:
- Q06495
- Synonyms:
- FRTS2;HCINF2;Na(+)-dependent phosphate cotransporter 2A;Na(+)/Pi cotransporter 2A;Na+-phosphate cotransporter type II;naPi-2a;NAPI-3;NPHLOP1;NPT2;NPTIIa;renal sodium-dependent phosphate transporter;SLC11;SLC17A2;sodium-dependent phosphate transport protein 2A;sodium-phosphate transport protein 2A;sodium/phosphate co-transporter;sodium/phosphate cotransporter 2A;solute carrier family 17 (sodium phosphate), member 2;solute carrier family 34 (sodium phosphate), member 1;solute carrier family 34 (type II sodium/phosphate cotransporter), member 1;Solute carrier family 34 member 1
- Extra Details:
- Enables sodium:phosphate symporter activity. Involved in several processes, including phosphate ion homeostasis; phosphate ion transport; and response to lead ion. Located in several cellular components, including apical plasma membrane; mitotic spindle; and nuclear speck. Implicated in several diseases, including Fanconi syndrome (multiple); chronic kidney disease; hereditary hypophosphatemic rickets with hypercalciuria; hypophosphatemic nephrolithiasis/osteoporosis 1; and nephrolithiasis.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
_WB_02.jpg)