A6718
RECK Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6718
- Additional Names:
- RECK|ST15
- Application:
- ELISA, WB
- Molecular Weight:
- 106kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP
- Uniprot:
- O95980
- Synonyms:
- membrane-anchored glycoprotein (metastasis and invasion);reversion-inducing cysteine-rich protein with Kazal motifs;ST15;suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein with kazal motifs);suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein with kazal motifs);suppressor of tumorigenicity 15 protein
- Extra Details:
- The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice