PP2A Catalytic A Alpha Rabbit polyclonal antibody

Size

£152.00

SKU:: A6702
Additional Names:: NEDLBA|PP2A Catalytic A Alpha|PP2Ac|PP2CA|PP2Calpha|RP-C
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Uniprot:: P67775
Synonyms:: NEDLBA;PP2A-alpha;PP2Ac;PP2CA;PP2Calpha;protein phosphatase 2, catalytic subunit, alpha isozyme;replication protein C;RP-C;serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Extra Details:: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

Shipping Conditions:: Blue Ice