PNKP Rabbit polyclonal antibody

Size

£152.00

SKU:: A6693
Additional Names:: AOA4|CMT2B2|EIEE10|MCSZ|PNK|PNKP
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLP
Uniprot:: Q96T60
Synonyms:: AOA4;bifunctional polynucleotide phosphatase/kinase;CMT2B2;DNA 5'-kinase/3'-phosphatase;EIEE10;Homo sapiens polynucleotide kinase 3'-phosphatase (PNKP);MCSZ;PNK;Polynucleotide kinase-3'-phosphatase
Extra Details:: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.