A6681
OSMR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6681
- Additional Names:
- IL-31R-beta|IL-31RB|OSMR|OSMRB|OSMRbeta|PLCA1
- Application:
- ELISA, WB
- Molecular Weight:
- 111kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNL
- Uniprot:
- Q99650
- Synonyms:
- IL-31 receptor subunit beta;IL-31R subunit beta;IL-31R-beta;IL-31RB;interleukin-31 receptor subunit beta;oncostatin-M specific receptor beta subunit;oncostatin-M-specific receptor subunit beta;OSMRB;OSMRbeta;PLCA1
- Extra Details:
- This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

