A6672
NMNAT1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6672
- Additional Names:
- LCA9|NMNAT|NMNAT1|PNAT1|SHILCA
- Application:
- ELISA, WB
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPK
- Uniprot:
- Q9HAN9
- Synonyms:
- LCA9;NaMN adenylyltransferase 1;nicotinamide mononucleotide adenylyltransferase 1;Nicotinamide-nucleotide adenylyltransferase 1;nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1;nicotinate-nucleotide adenylyltransferase 1;NMN adenylyltransferase 1;NMN/NaMN adenylyltransferase 1;NMNAT;PNAT1;pyridine nucleotide adenylyltransferase 1;SHILCA
- Extra Details:
- This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15.
- Shipping Conditions:
- Blue Ice

