NHLRC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6669
Additional Names:: bA204B7.2|EPM2A|EPM2B|MALIN|NHLRC1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 42kDa/45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLE
Uniprot:: Q6VVB1
Synonyms:: bA204B7.2;E3 ubiquitin-protein ligase NHLRC1;EPM2A;EPM2B;MALIN;NHL repeat containing 1;NHL repeat-containing protein 1;RING-type E3 ubiquitin transferase NHLRC1
Extra Details:: The protein encoded by this gene is a single subunit E3 ubiquitin ligase. Laforin is polyubiquitinated by the encoded protein. Defects in this intronless gene lead to an accumulation of laforin and onset of Lafora disease, also known as progressive myoclonic epilepsy type 2 (EPM2).