KCNH1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6636
Additional Names:: EAG|EAG1|h-eag|hEAG|hEAG1|KCNH1|Kv10.1|TMBTS|ZLS1
Application:: ELISA, WB
Molecular Weight:: 111kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGAS
Uniprot:: O95259
Synonyms:: EAG;EAG channel 1;EAG1;ether-a-go-go 1;ether-a-go-go potassium channel 1;ether-a-go-go, Drosophila, homolog of;h-eag;hEAG;hEAG1;Kv10.1;potassium channel, voltage gated eag related subfamily H, member 1;potassium voltage-gated channel subfamily H member 1;potassium voltage-gated channel, subfamily H (eag-related), member 1;TMBTS;voltage-gated potassium channel subunit Kv10.1;ZLS1
Extra Details:: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.

Shipping Conditions:: Blue Ice