GALNT3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6596
Additional Names:: GalNAc-T3|GALNT3|HFTC|HFTC1|HHS
Application:: ELISA, WB
Molecular Weight:: 73kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE
Uniprot:: Q14435
Synonyms:: GalNAc transferase 3;GalNAc-T3;HFTC;HFTC1;HHS;polypeptide GalNAc transferase 3;polypeptide GalNAc-transferase T3;polypeptide N-acetylgalactosaminyltransferase 3;pp-GaNTase 3;protein-UDP acetylgalactosaminyltransferase 3;UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3;UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
Extra Details:: This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities.

Shipping Conditions:: Blue Ice