GALE Rabbit polyclonal antibody

Size

£152.00

SKU:: A6595
Additional Names:: GALE|SDR1E1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Uniprot:: Q14376
Synonyms:: epididymis secretory sperm binding protein;galactose-4-epimerase, UDP-;galactowaldenase;SDR1E1;short chain dehydrogenase/reductase family 1E, member 1;UDP galactose-4'-epimerase;UDP-galactose 4-epimerase;UDP-GalNAc 4-epimerase;UDP-GlcNAc 4-epimerase;UDP-glucose 4-epimerase;UDP-N-acetylgalactosamine 4-epimerase;UDP-N-acetylglucosamine 4-epimerase
Extra Details:: This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified.

Shipping Conditions:: Blue Ice