A6595
GALE Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6595
- Additional Names:
- GALE|SDR1E1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
- Uniprot:
- Q14376
- Synonyms:
- epididymis secretory sperm binding protein;galactose-4-epimerase, UDP-;galactowaldenase;SDR1E1;short chain dehydrogenase/reductase family 1E, member 1;UDP galactose-4'-epimerase;UDP-galactose 4-epimerase;UDP-GalNAc 4-epimerase;UDP-GlcNAc 4-epimerase;UDP-glucose 4-epimerase;UDP-N-acetylgalactosamine 4-epimerase;UDP-N-acetylglucosamine 4-epimerase
- Extra Details:
- This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified.
- Shipping Conditions:
- Blue Ice

