A6585
ETFDH Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6585
- Additional Names:
- ETFDH|ETFQO|MADD
- Application:
- ELISA, WB
- Molecular Weight:
- 64kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM
- Uniprot:
- Q16134
- Synonyms:
- electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial;electron-transferring-flavoprotein dehydrogenase;ETF dehydrogenase;ETF-QO;ETF-ubiquinone oxidoreductase;ETFQO;MADD;mutant electron transfer flavoprotein dehydrogenase
- Extra Details:
- This gene encodes a component of the electron-transfer system in mitochondria and is essential for electron transfer from a number of mitochondrial flavin-containing dehydrogenases to the main respiratory chain. Mutations in this gene are associated with glutaric acidemia. Alternatively spliced transcript variants that encode distinct isoforms have been observed.
- Shipping Conditions:
- Blue Ice