A6567
CREB3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6567
- Additional Names:
- CREB3|LUMAN|LZIP|sLZIP
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 41kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTC
- Uniprot:
- O43889
- Synonyms:
- basic leucine zipper protein;cyclic AMP response element (CRE)-binding protein/activating transcription factor 1;cyclic AMP-responsive element-binding protein 3;leucin zipper proitein;Leucine zipper protein;LUMAN;LZIP;sLZIP;small leucine zipper protein;transcription factor LZIP-alpha
- Extra Details:
- This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.
- Shipping Conditions:
- Blue Ice