A6547
CCT3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6547
- Additional Names:
- CCT-gamma|CCT3|CCTG|PIG48|TCP-1-gamma|TRIC5
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA
- Uniprot:
- P49368
- Synonyms:
- CCT-gamma;CCTG;chaperonin containing TCP1, subunit 3 (gamma);hTRiC5;PIG48;T-complex protein 1 subunit gamma;T-complex protein 1, gamma subunit;TCP-1-gamma;TCP1 (t-complex-1) ring complex, polypeptide 5;TRIC5
- Extra Details:
- The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
- Shipping Conditions:
- Blue Ice