ATP6AP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6531
Additional Names:: APT6M8-9|ATP6AP2|ATP6IP2|ATP6M8-9|CDG2R|ELDF10|HT028|M8-9|MRXE|MRXSH|MSTP009|PRR|RENR|XMRE|XPDS
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Uniprot:: O75787
Synonyms:: APT6M8-9;ATP6IP2;ATP6M8-9;ATPase H(+)-transporting lysosomal accessory protein 2;ATPase H(+)-transporting lysosomal-interacting protein 2;ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9;ATPase, H+ transporting, lysosomal accessory protein 2;ATPase, H+ transporting, lysosomal interacting protein 2;CDG2R;ELDF10;embryonic liver differentiation factor 10;ER-localized type I transmembrane adapter;ER-localized type I transmembrane adaptor;HT028;M8-9;MRXE;MRXSH;MSTP009;N14F;prorenin receptor;PRR;renin receptor;renin/prorenin receptor;RENR;V-ATPase M8.9 subunit;vacuolar ATP synthase membrane sector-associated protein M8-9;vacuolar proton ATP synthase membrane sector associated protein M8-9;XMRE;XPDS
Extra Details:: This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Shipping Conditions:: Blue Ice