ALAS1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6521
Additional Names:: ALAS|ALAS-H|ALAS1|ALAS3|ALASH|MIG4
Application:: ELISA, WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCS
Uniprot:: P13196
Synonyms:: 5-aminolevulinate synthase, nonspecific, mitochondrial;5-aminolevulinic acid synthase 1;ALAS;ALAS-H;ALAS3;ALASH;aminolevulinate, delta-, synthase 1;delta-ALA synthase 1;delta-aminolevulinate synthase 1;MIG4;migration-inducing protein 4
Extra Details:: This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice