A6512
MARK2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A6512
- Additional Names:
- EMK-1|EMK1|MARK2|PAR-1|Par-1b|Par1b
- Application:
- ELISA, WB
- Molecular Weight:
- 78kDa/82kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
- Uniprot:
- Q7KZI7
- Synonyms:
- ELKL motif kinase 1;EMK-1;EMK1;MAP/microtubule affinity-regulating kinase 2;PAR-1;Par-1b;PAR1 homolog;PAR1 homolog b;Par1b;Ser/Thr protein kinase PAR-1B;serine/threonine protein kinase EMK;serine/threonine-protein kinase MARK2;testicular tissue protein Li 117
- Extra Details:
- This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice