A6481
LNX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6481
- Additional Names:
- LNX|LNX1|MPDZ|PDZRN2
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKE
- Uniprot:
- Q8TBB1
- Synonyms:
- E3 ubiquitin-protein ligase LNX;Ligand of Numb-protein X 1;ligand of numb-protein X 1, E3 ubiquitin protein ligase;LNX;MPDZ;multi-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX;numb-binding protein 1;PDZ domain-containing ring finger protein 2;PDZRN2;RING-type E3 ubiquitin transferase LNX
- Extra Details:
- This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene.
- Shipping Conditions:
- Blue Ice