A6467
POLR3K Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6467
- Additional Names:
- C11|C11-RNP3|HLD21|My010|POLR3K|RPC10|RPC11|RPC12.5
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
- Uniprot:
- Q9Y2Y1
- Synonyms:
- C11;C11-RNP3;DNA-directed RNA polymerase III subunit K;DNA-directed RNA polymerase III subunit RPC10;DNA-directed RNA polymerases III 12.5 kDa polypeptide;HLD21;My010;polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa;polymerase (RNA) III subunit K;RNA polymerase III 12.5 kDa subunit;RNA polymerase III subunit C10;RNA polymerase III subunit C11;RNA polymerase III subunit CII;RPC10;RPC11;RPC12.5
- Extra Details:
- This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.
- Shipping Conditions:
- Blue Ice

