A6465
AHSP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6465
- Additional Names:
- AHSP|EDRF|ERAF
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
- Uniprot:
- Q9NZD4
- Synonyms:
- alpha hemoglobin stabilising protein;alpha-hemoglobin-stabilizing protein;EDRF;ERAF;erythroid differentiation associated factor;erythroid differentiation-related factor;Erythroid-associated factor
- Extra Details:
- This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice