A6452
LYVE1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6452
- Additional Names:
- CRSBP-1|HAR|LYVE-1|LYVE1|XLKD1
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT
- Uniprot:
- Q9Y5Y7
- Synonyms:
- cell surface retention sequence binding protein-1;Cell surface retention sequence-binding protein 1;CRSBP-1;extracellular link domain-containing 1;extracellular link domain-containing protein 1;HAR;hyaluronic acid receptor;lymphatic vessel endothelial hyaluronic acid receptor 1;LYVE-1;XLKD1
- Extra Details:
- This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
- Shipping Conditions:
- Blue Ice

