A6398
KLK10 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6398
- Additional Names:
- KLK10|NES1|PRSSL1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
- Uniprot:
- O43240
- Synonyms:
- breast normal epithelial cell associated serine protease;kallikrein 10 protein 1;kallikrein 10 protein 12;kallikrein 10 protein 13;kallikrein 10 protein 2;kallikrein 10 protein 3;kallikrein 10 protein 4;kallikrein 10 protein 5;kallikrein 10 protein 7;kallikrein 10 protein 8;kallikrein 10 protein 9;kallikrein-10;NES1;normal epithelial cell-specific 1;protease serine-like 1;PRSSL1
- Extra Details:
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
- Shipping Conditions:
- Blue Ice







