NDUFS4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6390
Additional Names:: AQDQ|CI-18|CI-18 kDa|CI-AQDQ|MC1DN1|NDUFS4
Application:: ELISA, WB, IHC-P
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Uniprot:: O43181
Synonyms:: AQDQ;CI-18;CI-18 kDa;CI-AQDQ;complex I 18kDa subunit;Complex I-18 kDa;complex I-AQDQ;MC1DN1;mitochondrial respiratory chain complex I (18-KD subunit);NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial;NADH-ubiquinone oxidoreductase 18 kDa subunit
Extra Details:: This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants.