A6355
Arginase 2 (ARG2) Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6355
- Additional Names:
- ARG2|Arginase 2 (ARG2)
- Application:
- ELISA, WB
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
- Uniprot:
- P78540
- Synonyms:
- arginase II;arginase-2, mitochondrial;arginase, type II;kidney arginase;kidney-type arginase;L-arginine amidinohydrolase;L-arginine ureahydrolase;non-hepatic arginase;nonhepatic arginase;type II arginase
- Extra Details:
- Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described.
- Shipping Conditions:
- Blue Ice



