PCGF1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6338
Additional Names:: 2010002K04Rik|NSPC1|PCGF1|RNF3A-2|RNF68
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Uniprot:: Q9BSM1
Synonyms:: 2010002K04Rik;nervous system Polycomb-1;NSPC1;polycomb group RING finger protein 1;RING finger protein 68;RNF3A-2;RNF68
Extra Details:: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).