DHRS9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6324
Additional Names:: 3-alpha-HSD|3ALPHA-HSD|DHRS9|hRoDH-E2|RDH-TBE|RDH15|RDHL|RDHTBE|RETSDR8|SDR9C4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Uniprot:: Q9BPW9
Synonyms:: 3-alpha hydroxysteroid dehydrogenase;3-alpha-HSD;3ALPHA-HSD;dehydrogenase/reductase (SDR family) member 9;dehydrogenase/reductase SDR family member 9;NADP-dependent retinol dehydrogenase/reductase;RDH-E2;RDH-TBE;RDH15;RDHL;RDHTBE;retinol dehydrogenase 15;retinol dehydrogenase homolog;RETSDR8;SDR9C4;short chain dehydrogenase/reductase family 9C member 4;short-chain dehydrogenase/reductase retSDR8;tracheobronchial epithelial cell-specific retinol dehydrogenase
Extra Details:: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice