TAC3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6312
Additional Names:: HH10|LncZBTB39|NK3|NKB|NKNB|PRO1155|TAC3|ZNEUROK1
Application:: ELISA, WB, IF
Molecular Weight:: 16kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Uniprot:: Q9UHF0
Synonyms:: gamma tachykinin 3;HH10;LncZBTB39;LncZBTB39-1:2;neurokinin b;neuromedin K;NK3;NKB;NKNB;preprotachykinin B;PRO1155;tachykinin 3;tachykinin-3;ZNEUROK1
Extra Details:: This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Shipping Conditions:: Blue Ice