A6299
NEU1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6299
- Additional Names:
- NANH|NEU|NEU1|SIAL1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 45 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
- Uniprot:
- Q99519
- Synonyms:
- acetylneuraminyl hydrolase;exo-alpha-sialidase;G9 sialidase;lysosomal sialidase;N-acetyl-alpha-neuraminidase 1;NANH;NEU;SIAL1;sialidase 1 (lysosomal sialidase);sialidase-1
- Extra Details:
- The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity.
- Shipping Conditions:
- Blue Ice