A6282
BNIP2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6282
- Additional Names:
- BNIP-2|BNIP2|NIP2
- Application:
- ELISA, WB
- Molecular Weight:
- 45-55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGY
- Uniprot:
- Q12982
- Synonyms:
- BCL2/adenovirus E1B 19 kDa protein-interacting protein 2;BCL2/adenovirus E1B 19kDa interacting protein 2;BNIP-2;NIP2
- Extra Details:
- This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

