Annexin A4/Annexin IV Rabbit polyclonal antibody

Size

£152.00

SKU:: A6280
Additional Names:: Annexin A4/Annexin IV|ANX4|HEL-S-274|P32.5|PAP-II|PIG28|PP4-X|ZAP36
Application:: ELISA, WB
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Uniprot:: P09525
Synonyms:: 35-beta calcimedin;annexin A4;Annexin IV;annexin IV (placental anticoagulant protein II);annexin-4;ANX4;carbohydrate-binding protein p33/p41;chromobindin-4;endonexin I;epididymis secretory protein Li 274;HEL-S-274;lipocortin IV;P32.5;PAP-II;PIG28;placental anticoagulant protein II;PP4-X;proliferation-inducing gene 28;proliferation-inducing protein 28;protein II;ZAP36
Extra Details:: Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice