A6255
ETV7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6255
- Additional Names:
- ETV7|TEL-2|TEL2|TELB
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA
- Uniprot:
- Q9Y603
- Synonyms:
- Ets transcription factor TEL-2b;ETS translocation variant 7;ETS variant 7;ets variant gene 7 (TEL2 oncogene);ETS-related protein Tel2;TEL-2;tel-related Ets factor;TEL2;TEL2 oncogene;TELB;transcription factor ETV7;Transcription factor Tel-2
- Extra Details:
- The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).
- Shipping Conditions:
- Blue Ice

