A6251
COG2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6251
- Additional Names:
- CDG2Q|COG2|LDLC
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 88kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVEKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLL
- Uniprot:
- Q14746
- Synonyms:
- brefeldin A-sensitive, peripheral Golgi protein;CDG2Q;COG complex subunit 2;Component of oligomeric Golgi complex 2;conserved oligomeric Golgi complex protein 2;conserved oligomeric Golgi complex subunit 2;LDLC;low density lipoprotein receptor defect C complementing;low density lipoprotein receptor defect C-complementing protein
- Extra Details:
- This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice