A6248
GAB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6248
- Additional Names:
- DFNB26|GAB1
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
- Uniprot:
- Q13480
- Synonyms:
- deafness, autosomal recessive 26;DFNB26;GRB2-associated binder 1;GRB2-associated-binding protein 1;growth factor receptor bound protein 2-associated protein 1;symbol withdrawn, see GAB1
- Extra Details:
- The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

