A6244
PHLDA2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6244
- Additional Names:
- BRW1C|BWR1C|HLDA2|IPL|PHLDA2|TSSC3
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human, Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
- Uniprot:
- Q53GA4
- Synonyms:
- beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein;BRW1C;BWR1C;HLDA2;imprinted in placenta and liver protein;IPL;p17-Beckwith-Wiedemann region 1 C;p17-Beckwith-Wiedemann region 1C;p17-BWR1C;pleckstrin homology-like domain family A member 2;TSSC3;tumor suppressing subchromosomal transferable fragment cDNA 3;tumor suppressing subtransferable candidate 3;Tumor-suppressing STF cDNA 3 protein;tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein;tumor-supressing STF cDNA 3
- Extra Details:
- This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver.
- Shipping Conditions:
- Blue Ice