A6232
KCNJ5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6232
- Additional Names:
- CIR|GIRK4|KATP1|KCNJ5|KIR3.4|LQT13
- Application:
- ELISA, WB
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTI
- Uniprot:
- P48544
- Synonyms:
- cardiac ATP-sensitive potassium channel;Cardiac inward rectifier;CIR;G protein-activated inward rectifier potassium channel 4;GIRK4;heart KATP channel;Inward rectifier K(+) channel Kir3.4;inward rectifier K+ channel KIR3.4;IRK-4;KATP-1;KATP1;KIR3.4;LQT13;Potassium channel, inwardly rectifying subfamily J member 5;potassium channel, inwardly rectifying subfamily J, member 5;potassium voltage-gated channel subfamily J member 5
- Extra Details:
- This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas.
- Shipping Conditions:
- Blue Ice

