ADAM5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6196
Additional Names:: ADAM5|ADAM5P|TMDCII
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NCGTAHCLFQHILCGKLVCTWEHRDLISRPNLSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM
Uniprot:: Q6NVV9
Synonyms:: a disintegrin and metalloproteinase domain 5;ADAM5P;Putative transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein II;tMDC II;TMDCII
Extra Details:: Predicted to be involved in binding activity of sperm to zona pellucida and cell adhesion.