A6192
ANKRD1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6192
- Additional Names:
- ALRP|ANKRD1|bA320F15.2|C-193|CARP|CVARP|MCARP
- Application:
- ELISA, WB
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
- Uniprot:
- Q15327
- Synonyms:
- ALRP;ankyrin repeat domain 1 (cardiac muscle);ankyrin repeat domain-containing protein 1;bA320F15.2;C-193;cardiac ankyrin repeat protein;CARP;CVARP;cytokine-inducible gene C-193 protein;cytokine-inducible nuclear protein;epididymis secretory sperm binding protein;liver ankyrin repeat domain 1;MCARP
- Extra Details:
- The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.
- Shipping Conditions:
- Blue Ice

