A6141
IL31RA Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6141
- Additional Names:
- CRL|CRL3|GLM-R|GLMR|GPL|hGLM-R|IL-31RA|IL31RA|PLCA2|PRO21384|zcytoR17
- Application:
- ELISA, WB
- Molecular Weight:
- 41kDa/70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVEN
- Uniprot:
- Q8NI17
- Synonyms:
- class I cytokine receptor;CRL;CRL3;cytokine receptor-like 3;GLM-R;GLMR;gp130-like monocyte receptor;GPL;hGLM-R;IL-31 receptor subunit alpha;IL-31R subunit alpha;IL-31RA;interleukin-31 receptor subunit alpha;PLCA2;PRO21384;soluble type I cytokine receptor CRL3;zcytoR17
- Extra Details:
- The protein encoded by this gene belongs to the type I cytokine receptor family. This receptor, with homology to gp130, is expressed on monocytes, and is involved in IL-31 signaling via activation of STAT-3 and STAT-5. It functions either as a monomer, or as part of a receptor complex with oncostatin M receptor (OSMR). Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
- Shipping Conditions:
- Blue Ice