TRPM2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A6137
Additional Names:: EREG1|KNP3|LTrpC-2|LTRPC2|NUDT9H|NUDT9L1|TRPC7|TRPM2
Application:: ELISA, WB, IF
Molecular Weight:: 171kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNEKVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY
Uniprot:: O94759
Synonyms:: EREG1;estrogen-responsive element-associated gene 1 protein;KNP3;long transient receptor potential channel 2;LTrpC-2;LTRPC2;NUDT9H;NUDT9L1;transient receptor potential cation channel subfamily M member 2;transient receptor potential channel 7;transient receptor potential melastatin 2;TRPC7
Extra Details:: The protein encoded by this gene forms a tetrameric cation channel that is permeable to calcium, sodium, and potassium and is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. Additional transcript variants of this gene have been described, but their full-length nature is not known.

Shipping Conditions:: Blue Ice