A6137
TRPM2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6137
- Additional Names:
- EREG1|KNP3|LTrpC-2|LTRPC2|NUDT9H|NUDT9L1|TRPC7|TRPM2
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 171kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNEKVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY
- Uniprot:
- O94759
- Synonyms:
- EREG1;estrogen-responsive element-associated gene 1 protein;KNP3;long transient receptor potential channel 2;LTrpC-2;LTRPC2;NUDT9H;NUDT9L1;transient receptor potential cation channel subfamily M member 2;transient receptor potential channel 7;transient receptor potential melastatin 2;TRPC7
- Extra Details:
- The protein encoded by this gene forms a tetrameric cation channel that is permeable to calcium, sodium, and potassium and is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. Additional transcript variants of this gene have been described, but their full-length nature is not known.
- Shipping Conditions:
- Blue Ice





