TNFRSF10D Rabbit polyclonal antibody

Size

£152.00

SKU:: A6136
Additional Names:: CD264|DCR2|TNFRSF10D|TRAIL-R4|TRAILR4|TRUNDD
Application:: ELISA, WB, IHC-P
Molecular Weight:: 47kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Uniprot:: Q9UBN6
Synonyms:: CD264;DCR2;decoy receptor 2;TNF receptor-related receptor for TRAIL;TNF-related apoptosis-inducing ligand receptor 4;TRAIL receptor 4;TRAIL receptor with a truncated death domain;TRAIL-R4;TRAILR4;TRUNDD;tumor necrosis factor receptor superfamily member 10D;tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.