A6091
ELAVL3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6091
- Additional Names:
- ELAVL3|HUC|HUCL|PLE21
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 37 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA
- Uniprot:
- Q14576
- Synonyms:
- ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C);ELAV like neuron-specific RNA binding protein 3;ELAV-like protein 3;Hu antigen C;hu-antigen C;HUC;HUCL;paraneoplastic cerebellar degeneration-associated antigen;paraneoplastic limbic encephalitis antigen 21;PLE21
- Extra Details:
- A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice