A6075
TIAL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6075
- Additional Names:
- TCBP|TIAL1|TIAR
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
- Uniprot:
- Q01085
- Synonyms:
- aging-associated gene 7 protein;nucleolysin TIAR;T-cluster binding protein;TCBP;TIA-1-related nucleolysin;TIA-1-related protein;TIA1 related;TIAR
- Extra Details:
- The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.
- Shipping Conditions:
- Blue Ice