A6067
SRSF3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A6067
- Additional Names:
- SFRS3|SRp20|SRSF3
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNR
- Uniprot:
- P84103
- Synonyms:
- epididymis secretory sperm binding protein;pre-mRNA splicing factor SRp20;pre-mRNA-splicing factor SRP20;serine/arginine-rich splicing factor 3;SFRS3;splicing factor, arginine/serine-rich 3;splicing factor, arginine/serine-rich, 20-kD;SRp20
- Extra Details:
- The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.
- Shipping Conditions:
- Blue Ice








