A6024
SRSF10 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6024
- Additional Names:
- FUSIP1|FUSIP2|NSSR|PPP1R149|SFRS13|SFRS13A|SRp38|SRrp40|SRSF10|TASR|TASR1|TASR2
- Application:
- ELISA, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
- Uniprot:
- O75494
- Synonyms:
- 40 kDa SR-repressor protein;FUS interacting protein (serine-arginine rich) 1;FUS-interacting protein (serine-arginine rich) 2;FUS-interacting serine-arginine-rich protein 1;FUSIP1;FUSIP2;neural-salient SR protein;NSSR;PPP1R149;protein phosphatase 1, regulatory subunit 149;serine-arginine repressor protein (40 kDa);serine/arginine-rich splicing factor 10;SFRS13;SFRS13A;splicing factor SRp38;splicing factor, arginine/serine-rich 13;splicing factor, arginine/serine-rich 13A;SR splicing factor 10;SRp38;SRrp40;TASR;TASR1;TASR2;TLS-associated protein TASR;TLS-associated protein with Ser-Arg repeats;TLS-associated protein with SR repeats;TLS-associated serine-arginine protein;TLS-associated serine-arginine protein 1;TLS-associated serine-arginine protein 2;TLS-associated SR protein
- Extra Details:
- This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice