Aconitase 1 (ACO1) Rabbit polyclonal antibody

Size

£152.00

SKU:: A6008
Additional Names:: Aconitase 1 (ACO1)|ACONS|HEL60|IREB1|IREBP|IREBP1|IRP1
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDS
Uniprot:: P21399
Synonyms:: aconitase 1, soluble;aconitate hydratase, cytoplasmic;ACONS;citrate hydro-lyase;cytoplasmic aconitase;cytoplasmic aconitate hydratase;cytosplasmic aconitase;epididymis luminal protein 60;epididymis secretory sperm binding protein;ferritin repressor protein;HEL60;IREB1;IREBP;IREBP1;iron regulatory protein 1;iron-responsive element-binding protein 1;IRP1;soluble aconitase
Extra Details:: The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants

Shipping Conditions:: Blue Ice