A6004
Musashi-2 (MSI2) Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A6004
- Additional Names:
- MSI2H|Musashi-2 (MSI2)
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLG
- Uniprot:
- Q96DH6
- Synonyms:
- MSI2H;musashi homolog 2;musashi-2;RNA-binding protein Musashi homolog 2
- Extra Details:
- This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells.
- Shipping Conditions:
- Blue Ice