A5992
NSUN5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5992
- Additional Names:
- NOL1|NOL1R|NSUN5|NSUN5A|p120|p120(NOL1)|WBSCR20|WBSCR20A
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 47kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
- Uniprot:
- Q96P11
- Synonyms:
- 28S rRNA (cytosine-C(5))-methyltransferase;NOL1;NOL1-related protein;NOL1/NOP2/Sun domain family member 5;NOL1R;NOP2/Sun domain family, member 5;NOP2/Sun domain family, member 5A;NOP2/Sun RNA methyltransferase family member 5;NSUN5A;p120;p120(NOL1);probable 28S rRNA (cytosine-C(5))-methyltransferase;putative methyltransferase NSUN5;WBSCR20;WBSCR20A;Williams Beuren syndrome chromosome region 20A;Williams-Beuren syndrome chromosomal region 20A protein;Williams-Beuren syndrome critical region protein 20 copy A
- Extra Details:
- This gene encodes a member of an evolutionarily conserved family of proteins that may function as methyltransferases. This gene is located in a larger region of chromosome 7 that is deleted in Williams-Beuren syndrome, a multisystem developmental disorder. There are two pseudogenes for this gene located in the same region of chromosome 7. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice