A5942
FXR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5942
- Additional Names:
- CMYP9A|CMYP9B|FXR1|FXR1P|MYOPMIL|MYORIBF
- Application:
- ELISA, WB
- Molecular Weight:
- 68kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL
- Uniprot:
- P51114
- Synonyms:
- fragile X mental retardation syndrome-related protein 1;fragile X mental retardation, autosomal homolog 1;FXR1P;MYOPMIL;MYORIBF
- Extra Details:
- The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice